PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C018776P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 273aa    MW: 31899.8 Da    PI: 6.7059
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C018776P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd++l+d+v+++G  +W++ ++  g+ R++k+c++rw +yl
   MELO3C018776P1 15 KGVWTPEEDQKLIDYVNKYGHWNWRRLPKFAGLLRCGKSCRLRWINYL 62
                     799*****************99**********99************97 PP

2Myb_DNA-binding574.5e-1868113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ ++eE++l++++++q+G++ W+ Ia +++ gRt++++k++w+++l
   MELO3C018776P1  68 RGNYSKEEEQLILQLHQQYGNK-WSMIATKLP-GRTDNEIKNYWHTHL 113
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-23765IPR009057Homeodomain-like
PROSITE profilePS5129415.8791062IPR017930Myb domain
SuperFamilySSF466891.09E-3013109IPR009057Homeodomain-like
SMARTSM007172.1E-131464IPR001005SANT/Myb domain
PfamPF002499.8E-161562IPR001005SANT/Myb domain
CDDcd001671.25E-101862No hitNo description
PROSITE profilePS5129426.49763117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2666115IPR009057Homeodomain-like
SMARTSM007171.1E-1767115IPR001005SANT/Myb domain
PfamPF002495.5E-1668113IPR001005SANT/Myb domain
CDDcd001671.83E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MAKCCCCCDE TTVKKGVWTP EEDQKLIDYV NKYGHWNWRR LPKFAGLLRC GKSCRLRWIN  60
YLRPDVKRGN YSKEEEQLIL QLHQQYGNKW SMIATKLPGR TDNEIKNYWH THLKKVKSNK  120
NTKKHQNEEI SGNNKSIQKR ETTIISENKT NLTNEIMPLS HQIFESSPIS TLSSEISTVT  180
SNQESTQDSP PTPLFKFQEE PYDHHNNGDL WVNPLFVAEN YLEAESDQNP INFGFIGGFN  240
QPYDFELLDE NYLFCQAMKE LPENYQSQLY PF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26151157106B-MYB
1h8a_C2e-261511527126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817920.0LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455365.10.0PREDICTED: transcription factor WER-like
TrEMBLA0A0A0K1Q02e-68A0A0A0K1Q0_CUCSA; Uncharacterized protein
STRINGVIT_12s0134g00480.t013e-63(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.12e-51myb domain protein 14